DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT4G35810

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:208 Identity:57/208 - (27%)
Similarity:101/208 - (48%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 MEELGLDPYMVVFHDVIYDTEIDGMLNSSDFGLSESV-------SGLKSEVRTSKDS-----HIV 346
            :|.:..:|...|:|:.:.:.|.:.:::.:...:.:|.       ..:.|.||||..:     |..
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   347 DAKTLNERVTDMTGLSMEMSDPFSLINYGLGGHFILHHD-FHEYTNTTRLKQGDRIATVLFYLRE 410
            ..:.:..|::|.|.:..|..:...:::|.:|..:..||| |.:..|..  |.|.||||||.||.:
plant   145 IVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVR--KGGQRIATVLMYLSD 207

  Fly   411 VDSGGATVFPML-------------------NITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPV 456
            ||.||.||||..                   .::|:|||..|:.::::....:::..:||..|||
plant   208 VDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGCPV 272

  Fly   457 ISGSKYVLTKWIN 469
            |.|:|:..|||.:
plant   273 IKGNKWSSTKWFH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 52/185 (28%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 57/208 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.