DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT4G33910

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:266 Identity:62/266 - (23%)
Similarity:100/266 - (37%) Gaps:84/266 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 FQHFENKPEGIVASNEVIHFEGVLATTQNCTAVVQ------KPS----KKLHCRYNTSTTPFTRI 289
            ||....:|..|...|        .||.:.|.|:::      |||    :|.....||..|     
plant    78 FQVLSWRPRAIYFPN--------FATAEQCQAIIERAKVNLKPSALALRKGETAENTKGT----- 129

  Fly   290 APLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSDFGLSESVSGLKSEVRTSKDSHIVDAKTLNER 354
                                  .|.....:::|:    ||...|               ..:..:
plant   130 ----------------------RTSSGTFISASE----ESTGAL---------------DFVERK 153

  Fly   355 VTDMTGLSMEMSDPFSLINYGLGGHFILHHDFHEYTNTTRL--KQGDRIATVLFYLREVDSGGAT 417
            :...|.:.....:.|:::.|.||..:..|:|..   |.|..  :...|||:.|.||.:|:.||.|
plant   154 IARATMIPRSHGESFNILRYELGQKYDSHYDVF---NPTEYGPQSSQRIASFLLYLSDVEEGGET 215

  Fly   418 VFPMLN---------------ITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKYVLTKW 467
            :||..|               :.|.|:||..:.:|::..:|.::..:||.:|||..|.|:|.|||
plant   216 MFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGEKWVATKW 280

  Fly   468 INELPQ 473
            |.:..|
plant   281 IRDQDQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 42/170 (25%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 62/266 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.