DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT3G28490

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:217 Identity:63/217 - (29%)
Similarity:92/217 - (42%) Gaps:42/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 IAPLKMEELGLDPYMVVFHDVIYDTEID-------GMLNSS------DFGLSESVSGLKSEVRTS 340
            :.|.::.:|...|...::...:.|.|.|       |.|..|      |.|.||.     ||||||
plant    27 VDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESED-----SEVRTS 86

  Fly   341 KDSHIVDAK-----TLNERVTDMTGLSMEMSDPFSLINYGLGGHFILHHDFHEYTNTTRLKQGDR 400
            ....:...:     .:..::...|.|..|..:...:::|..|..:..|.|:. |........|.|
plant    87 SGMFLTKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYF-YDKKALELGGHR 150

  Fly   401 IATVLFYLREVDSGGATVFP------------------MLNITVMPKKGSAVFWYNLHNSGAVNS 447
            |||||.||..|..||.||||                  .....|.|:||.|:.::|||.:|..:.
plant   151 IATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGTTDP 215

  Fly   448 KTLHTACPVISGSKYVLTKWIN 469
            .:||.:||||.|.|:..|:||:
plant   216 NSLHGSCPVIEGEKWSATRWIH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 57/189 (30%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 63/216 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.