DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT3G28480

DIOPT Version :10

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:231 Identity:67/231 - (29%)
Similarity:103/231 - (44%) Gaps:42/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 RYNTSTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEID-------GMLNSSDFGLSESVSGLKS 335
            :..||.:.| ...|.::.:|...|.:.::...:.|.|.|       |.|..|....::|...::|
plant    41 KMKTSASSF-GFDPTRVTQLSWTPRVFLYEGFLSDEECDHFIKLAKGKLEKSMVADNDSGESVES 104

  Fly   336 E-----VRTSK------DSHIVD--AKTLNERVTDMTGLSMEMSDPFSLINYGLGGHFILHHD-F 386
            |     ||.|.      ||..:|  ...:..::...|.|..|..:...:::|..|..:..|.| |
plant   105 EDSVSVVRQSSSFIANMDSLEIDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQKYEPHFDYF 169

  Fly   387 HEYTNTTRLKQGDRIATVLFYLREVDSGGATVFPM------------------LNITVMPKKGSA 433
            |:..|..  ..|.||||||.||..|:.||.|||||                  ....|.|:||.|
plant   170 HDQANLE--LGGHRIATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVKPRKGDA 232

  Fly   434 VFWYNLHNSGAVNSKTLHTACPVISGSKYVLTKWIN 469
            :.::|||.:...:|.:||.:|||:.|.|:..|:||:
plant   233 LLFFNLHPNATTDSNSLHGSCPVVEGEKWSATRWIH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..168 CDD:462433
P4Hc 314..468 CDD:214780 58/192 (30%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 64/220 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.