DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and P4H2

DIOPT Version :10

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:247 Identity:70/247 - (28%)
Similarity:105/247 - (42%) Gaps:50/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 VLATTQNCTAVVQKPSKKLHCRYNTSTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNS 321
            :|...|:.|.::..||              :.|.|.|::::...|...|:...:.|.|.|.:::.
plant    15 LLVLLQSSTCLISSPS--------------SIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISL 65

  Fly   322 SDFGLSESV-------SGLKSEVRTSKDSHIVDAKT-----LNERVTDMTGLSMEMSDPFSLINY 374
            :...|..|.       ....|:||||..:.|...|.     :.::::..|.|..|..:...::.|
plant    66 AKENLQRSAVADNDNGESQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRY 130

  Fly   375 GLGGHFILHHD-FHEYTNTTRLKQGDRIATVLFYLREVDSGGATVFP------------------ 420
            ..|..:..|.| ||:..|..|  .|.||||||.||..|..||.||||                  
plant   131 EHGQKYDAHFDYFHDKVNIAR--GGHRIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLS 193

  Fly   421 ---MLNITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKYVLTKWIN 469
               ...|.|.||||:|:.::||......:..:||..||||.|.|:..||||:
plant   194 DCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..168 CDD:462433
P4Hc 314..468 CDD:214780 57/187 (30%)
P4H2NP_566279.1 PLN00052 37..299 CDD:177683 63/211 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.