DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and P4H2

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:247 Identity:70/247 - (28%)
Similarity:105/247 - (42%) Gaps:50/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 VLATTQNCTAVVQKPSKKLHCRYNTSTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNS 321
            :|...|:.|.::..||              :.|.|.|::::...|...|:...:.|.|.|.:::.
plant    15 LLVLLQSSTCLISSPS--------------SIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISL 65

  Fly   322 SDFGLSESV-------SGLKSEVRTSKDSHIVDAKT-----LNERVTDMTGLSMEMSDPFSLINY 374
            :...|..|.       ....|:||||..:.|...|.     :.::::..|.|..|..:...::.|
plant    66 AKENLQRSAVADNDNGESQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRY 130

  Fly   375 GLGGHFILHHD-FHEYTNTTRLKQGDRIATVLFYLREVDSGGATVFP------------------ 420
            ..|..:..|.| ||:..|..|  .|.||||||.||..|..||.||||                  
plant   131 EHGQKYDAHFDYFHDKVNIAR--GGHRIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLS 193

  Fly   421 ---MLNITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKYVLTKWIN 469
               ...|.|.||||:|:.::||......:..:||..||||.|.|:..||||:
plant   194 DCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSLHGGCPVIEGEKWSATKWIH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 57/187 (30%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 59/191 (31%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.