DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:219 Identity:59/219 - (26%)
Similarity:103/219 - (47%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 NTSTTPFTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGM-------LNSSDFGLSESVSGLKSEV 337
            |.......||..:|.|.:...|.::|.||.:...|.:.:       |..|.....::..|:||:|
plant    63 NDKDAELLRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDV 127

  Fly   338 RTSKD---SHIVDA----KTLNERVTDMTGLSMEMSDPFSLINYGLGGHFILHHDFHEYTNTTRL 395
            |||..   :|:..:    :.:.:|:...:.:..|..:...::.|.....:..|||:  :.:|..|
plant   128 RTSSGMFLTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDY--FADTFNL 190

  Fly   396 KQ-GDRIATVLFYLREVDSGGATVFP-------------MLNITVMPKKGSAVFWYNLHNSGAVN 446
            |: |.|:||:|.||.:...||.|.||             |..|:|.|.||.||.::::...|..:
plant   191 KRGGQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSD 255

  Fly   447 SKTLHTACPVISGSKYVLTKWINE 470
            .:::|..|.|:||.|:..|||:.:
plant   256 PRSIHGGCEVLSGEKWSATKWMRQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 49/181 (27%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 54/202 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.