DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and P4H13

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:267 Identity:71/267 - (26%)
Similarity:107/267 - (40%) Gaps:78/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 TEAFQHFENKPEGIVASNEVIHFEGV-----------LATTQNCTAVVQKPSKKLHCRYNTSTTP 285
            |::..|      |...||  |.|.|:           .||.|.|.||:.....||        .|
plant    54 TDSLDH------GSSVSN--IPFHGLSWNPRVFYLPNFATKQQCEAVIDMAKPKL--------KP 102

  Fly   286 FTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSDFGLSESVSGLKS-EVRTSKDSHIVDAK 349
            .| :|..|.|                              .:|:....:| ...|.:|...|.| 
plant   103 ST-LALRKGE------------------------------TAETTQNYRSLHQHTDEDESGVLA- 135

  Fly   350 TLNERVTDMTGLSMEMSDPFSLINYGLGGHFILHHD-FHEYTNTTRLKQGDRIATVLFYLREVDS 413
            .:.|::...|....:..:.|:::.|.||..:..|:| ||.......:.|  |:.|.|.:|..|:.
plant   136 AIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEYGPLISQ--RVVTFLLFLSSVEE 198

  Fly   414 GGATVFPMLN---------------ITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKYV 463
            ||.|:||..|               :.|.|::|.|:|:|||..:|.::..:||.:||||.|.|:|
plant   199 GGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKWV 263

  Fly   464 LTKWINE 470
            .||||.:
plant   264 ATKWIRD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 48/170 (28%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 61/225 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.