DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and P4htm

DIOPT Version :10

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_083220.3 Gene:P4htm / 74443 MGIID:1921693 Length:503 Species:Mus musculus


Alignment Length:228 Identity:66/228 - (28%)
Similarity:97/228 - (42%) Gaps:69/228 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 DTEIDGMLNSSDFG------LSESVSGLKSE----VRTSKDS---------HIVDAKTLNERVTD 357
            |.:.||:|:..:|.      ..:.:...|:|    ||.|..:         |::  :.:.:||..
Mouse   238 DPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESNELVRNSHHTWLHQGEGAHHVM--RAIRQRVLR 300

  Fly   358 MTGLS---MEMSDPFSLINYGLGGHFILHHDFHE-YTNT----TRLKQGD--------RIATVLF 406
            :|.||   :|.|:|..::.||.|||:..|.|... |..|    |:|...:        |..||||
Mouse   301 LTRLSPEIVEFSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLF 365

  Fly   407 YLREVDSGGATVFPML---------------------------NITVMPKKGSAVFWYNLHNS-- 442
            ||..|..||.||||:.                           |:.|.|::|:||||||....  
Mouse   366 YLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQ 430

  Fly   443 ---GAVNSKTLHTACPVISGSKYVLTKWINELP 472
               |.|:..:||..|.|..|:|::...|||..|
Mouse   431 GWVGEVDDYSLHGGCLVTRGTKWIANNWINVDP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..168 CDD:462433
P4Hc 314..468 CDD:214780 61/220 (28%)
P4htmNP_083220.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
EF-hand_7 193..253 CDD:463900 5/14 (36%)
P4Hc 247..459 CDD:214780 58/213 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.