DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and P4HTM

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:289 Identity:66/289 - (22%)
Similarity:98/289 - (33%) Gaps:130/289 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 DTEIDGMLNSSDFG------LSESVSGLKSE----VRTSKDS---------HIVDAKTLNERVTD 357
            |.:.||:|:..:|.      ..:.:...|:|    ||.|..:         ||:  :.:.:||..
Human   237 DPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIM--RAIRQRVLR 299

  Fly   358 MTGLS---MEMSDPFSLINYGLGGHFILHHDFHE-YTNT----TRLKQGDRI------------- 401
            :|.||   :|:|:|..::.||.|||:..|.|... |..|    |:|...:.:             
Human   300 LTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNW 364

  Fly   402 --------------------------------------------------------ATVLFYLRE 410
                                                                    .||||||..
Human   365 GLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNN 429

  Fly   411 VDSGGATVFPML---------------------------NITVMPKKGSAVFWYNLHNSGA---- 444
            |..||.||||:.                           |:.|.|::|:||||||....|.    
Human   430 VTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVG 494

  Fly   445 -VNSKTLHTACPVISGSKYVLTKWINELP 472
             |:..:||..|.|..|:|::...|||..|
Human   495 DVDDYSLHGGCLVTRGTKWIANNWINVDP 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 61/281 (22%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 5/14 (36%)
EFh 194..252 CDD:238008 5/14 (36%)
P4Hc 246..519 CDD:214780 58/274 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149312
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.