DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and P4htm

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:228 Identity:66/228 - (28%)
Similarity:98/228 - (42%) Gaps:69/228 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 DTEIDGMLNSSDFG------LSESVSGLKSE----VRTSKDS---------HIVDAKTLNERVTD 357
            |.:.||:|:..:|.      ..:.:...|:|    ||.|..:         |::  :.:.:||..
  Rat   238 DPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVM--RAIRQRVLR 300

  Fly   358 MTGLS---MEMSDPFSLINYGLGGHFILHHDFHE-YTNT----TRLKQGD--------RIATVLF 406
            :|.||   :|:|:|..::.||.|||:..|.|... |..|    |:|...:        |..||||
  Rat   301 LTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLF 365

  Fly   407 YLREVDSGGATVFPML---------------------------NITVMPKKGSAVFWYNLHNS-- 442
            ||..|..||.||||:.                           |:.|.|::|:||||||....  
  Rat   366 YLNNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQ 430

  Fly   443 ---GAVNSKTLHTACPVISGSKYVLTKWINELP 472
               |.|:..:||..|.|..|:|::...|||..|
  Rat   431 GWVGEVDDYSLHGGCLVTRGTKWIANNWINVDP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 61/220 (28%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 5/14 (36%)
P4Hc 247..459 CDD:214780 58/213 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.