DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18749 and phy-3

DIOPT Version :9

Sequence 1:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:206 Identity:58/206 - (28%)
Similarity:100/206 - (48%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 PLKMEELGLDPYMVVFHDVIYDTEIDGMLN-----------SSDFGLSESVSGLKS--EVRTSKD 342
            |:.||.:...|.:|::.:::...:....||           :||||.|...:..::  .....:|
 Worm    82 PVDMEIISWAPTLVIYRNLMSPRQTASFLNFIEQRDLEIQKTSDFGTSIETTHRRANGSFIPPED 146

  Fly   343 SHI-VDAKTLNERVTDMTGLSMEMSDPFSLINYGLGGHFILHHDFHEYTNTTRLKQ--------- 397
            |:: |:.|...::  .:.||::.:::.||.::|..|||:.:|:|:.:|    |.||         
 Worm   147 SNVTVEIKMQAQK--RIPGLNLTVAEHFSALSYLPGGHYAVHYDYLDY----RSKQDYDWWMNKT 205

  Fly   398 GDRIATVLFYLREVDSGGATVFPMLNITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISGSKY 462
            |:||.|::|.|:..:.||.||||.:..||....|.|.||:|..........:.|..||:..|.|.
 Worm   206 GNRIGTLIFVLKPAEKGGGTVFPSIGSTVRANAGDAFFWFNAQADEEKEMLSNHGGCPIYEGRKV 270

  Fly   463 VLTKWINELPQ 473
            :.|.||....|
 Worm   271 IATIWIRAYNQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528
P4Hc 314..468 CDD:214780 50/176 (28%)
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 51/180 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.