Sequence 1: | NP_001027154.1 | Gene: | CG18749 / 3771984 | FlyBaseID: | FBgn0042182 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359861.1 | Gene: | C14E2.4 / 182616 | WormBaseID: | WBGene00015773 | Length: | 311 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 52/204 - (25%) |
---|---|---|---|
Similarity: | 92/204 - (45%) | Gaps: | 36/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 292 LKMEELGLDPYMVVFHDVIYDTEIDGMLNSSDFGLSESVSGLK-SEVRTSKD------------- 342
Fly 343 -------SHIVDAKTLNERVTDMTGL-SMEMSDPFSLINYGLGGHFILHHDFHEYTNTTRL---- 395
Fly 396 -KQGDRIATVLFYLREVDSGGATVFPMLNITVMPKKGSAVFWYNLHNSGAVNSKTLHTACPVISG 459
Fly 460 SKYVLTKWI 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18749 | NP_001027154.1 | P4Ha_N | 35..166 | CDD:285528 | |
P4Hc | 314..468 | CDD:214780 | 43/180 (24%) | ||
C14E2.4 | NP_001359861.1 | P4Hc | 100..276 | CDD:214780 | 45/185 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.770 |