DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33819 and H1f3

DIOPT Version :9

Sequence 1:NP_001027309.1 Gene:His1:CG33819 / 3771981 FlyBaseID:FBgn0053819 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_663759.3 Gene:H1f3 / 14957 MGIID:107502 Length:221 Species:Mus musculus


Alignment Length:262 Identity:108/262 - (41%)
Similarity:133/262 - (50%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKA--SGSAGTKAKKASATPSHPPTQQMVDASIKNLKER 63
            ||::|.|..|:     ||.|||..|:|||  :|:|..| :|||.    ||..:::..::...|||
Mouse     1 MSETAPAAPAA-----PAPVEKTPVKKKAKKTGAAAGK-RKASG----PPVSELITKAVAASKER 55

  Fly    64 GGSSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDP 127
            .|.||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:   ||....
Mouse    56 SGVSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN---KKAASG 115

  Fly   128 KAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAK 192
            :||.|              :||.|.:..|...|||.|..||..|...||||  |||.|...|.|.
Mouse   116 EAKPK--------------AKKAGAAKAKKPAGAAKKPKKATGAATPKKTA--KKTPKKAKKPAA 164

  Fly   193 KTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKA---KTTAA 254
            ..|  ..|.:.:..||.|||||    ||:|: ||.:..||         |.|.||||   |.|.|
Mouse   165 AAG--AKKVSKSPKKVKAAKPK----KAAKS-PAKAKAPK---------AKASKPKASKPKATKA 213

  Fly   255 KK 256
            ||
Mouse   214 KK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33819NP_001027309.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1f3NP_663759.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 22/50 (44%)
H15 35..115 CDD:238028 40/88 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 67/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10384
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4685
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.