DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG14455

DIOPT Version :9

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:148 Identity:32/148 - (21%)
Similarity:74/148 - (50%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AIKYKVPDIFEKMDCNLYQANNRSYVNVEMKLKKEVSDLNVRAIMEF-WKPNAQNKMKLYDVRVD 95
            :|.::..|.|..:..:|...:..|.:::::|..:::.|  |:.:::| .:.:..|...|.:..::
  Fly    35 SIDFEANDKFLDLKVDLQNDSGESNLSIDIKTHQDIED--VQLVVDFGLETDKGNYSTLINRTLN 97

  Fly    96 GCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAPVGQFRTVTE 160
            .|.:::..:.:.|.....:...||..:...||.::. ||.:.::.:|||.||.|.|..:||...:
  Fly    98 FCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSG-TYSLTNYNVDEEMLPSFLPEAKFRFGMK 161

  Fly   161 YFTQQ-RLIIRVVAHGAV 177
            ..|.: .:|:|....|.:
  Fly   162 ISTDKGGMIVRSTIFGRI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 17/75 (23%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.