DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG33648

DIOPT Version :10

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:156 Identity:38/156 - (24%)
Similarity:63/156 - (40%) Gaps:30/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IKYKVPDI----FEKMDCNLYQANNRSYVNVEMKLKKEVS------DLNVRAI----------ME 77
            |.|.:.|:    |..:.|:   :::.|||..|....|.|:      .:|.|.:          :.
  Fly    13 ILYGINDVSIVEFTNIKCS---SSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINVA 74

  Fly    78 FWKPNAQNKMKLYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNV-VLSCPFKANFTY-KMDDWF 140
            .:|.....|..||:|.||.|..|||...|.:..:........||: ..:|||.:..:. |:...|
  Fly    75 LYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNF 139

  Fly   141 LDE---EELPPFAPVGQFRTVTEYFT 163
            |:.   :.||  .|.|.:.....:|:
  Fly   140 LNNKLTQVLP--VPEGDYLFAFRWFS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:461928 24/80 (30%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 24/87 (28%)

Return to query results.
Submit another query.