DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG33688

DIOPT Version :10

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:117 Identity:31/117 - (26%)
Similarity:56/117 - (47%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KCENRRLRIFFDEFAIKYKVPDIFEKMDCNLYQANNRS--YVNVEMKLKKEVSDLNVRAIMEFWK 80
            ||..|..:|::            |||  | ..:|.||:  |:::.:.|.::|  :|...:::..:
  Fly    27 KCGIRGEKIYY------------FEK--C-FIKAVNRTHKYIDIYVNLHQQV--VNNVTVIKLMR 74

  Fly    81 PNAQNKMKLYDVRVDGCLILRTIHKN---KLFYFYVKSFKKHSNVVLSCPFK 129
            .|...|....||.:|.|..|:...::   ||:..|    |.:||:..:||:|
  Fly    75 HNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIY----KNNSNINHTCPYK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:461928 16/53 (30%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 16/55 (29%)

Return to query results.
Submit another query.