DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG33645

DIOPT Version :9

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster


Alignment Length:178 Identity:76/178 - (42%)
Similarity:117/178 - (65%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LYFICGLYFLMDLAKCENRRLRIFFDEFAIKYKVPDIFEKMDCNLYQANNRSYVNVEMKLKKEVS 68
            |:|...|.|  :..:||.|..|::..|..|.:...|::||.:|.:||.:||:|::.....|:.|.
  Fly     6 LFFSATLIF--NSMRCEERNFRVYIKEVNITHLDTDLYEKFECKVYQVDNRTYMDSVHIFKRTVD 68

  Fly    69 DLNVRAIMEFWKPNAQNKMKLYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFT 133
            |:.|.|.::|||.|::.|||||||:.:||.||...:||:||..||::.||||||...|||:||.:
  Fly    69 DITVHAALDFWKLNSKQKMKLYDVQFNGCYILENANKNRLFNMYVQNLKKHSNVKFKCPFRANVS 133

  Fly   134 YKMDDWFLDEEELPPFAPVGQFRTVTEYFTQQRLIIRVVAHGAVLPRS 181
            |::.:..:.|::.|.|.|:|:||::.||.|.|:|..||:|.|.:||.|
  Fly   134 YEVKNLTMSEQDFPSFVPLGKFRSLIEYCTNQKLRARVIASGQILPHS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 36/75 (48%)
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 36/75 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.