DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG33642

DIOPT Version :9

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:161 Identity:86/161 - (53%)
Similarity:113/161 - (70%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KCENRRLRIFFDEFAIKYKVPDIFEKMDCNLYQANNRSYVNVEMKLKKEVSDLNVRAIMEFWKPN 82
            |||.|..||..:|||:|||:.|:.:.:|..:...|||||||.||.:|.:|.|:.:...|:|||.:
  Fly    22 KCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDILMHTTMDFWKTS 86

  Fly    83 AQNKMKLYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELP 147
            .|.|:||||.|:|.|..|:|.|:|.||..||||||||.:..||||.:.||.|.:.:|.:||::||
  Fly    87 NQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNYTLTNWHMDEKDLP 151

  Fly   148 PFAPVGQFRTVTEYFTQQRLIIRVVAHGAVL 178
            ||.|:|.||||||||||.||.:|:|..|.||
  Fly   152 PFVPLGTFRTVTEYFTQDRLALRIVTQGKVL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 40/75 (53%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 43/80 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.