powered by:
Protein Alignment CG33641 and CG13193
DIOPT Version :9
Sequence 1: | NP_001027256.1 |
Gene: | CG33641 / 3771970 |
FlyBaseID: | FBgn0053641 |
Length: | 181 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610699.1 |
Gene: | CG13193 / 36256 |
FlyBaseID: | FBgn0033650 |
Length: | 189 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 18/75 - (24%) |
Similarity: | 39/75 - (52%) |
Gaps: | 2/75 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 LYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAPVG 153
|:...:|.|..||.:.::.|...::::..|:.|:...||.:. .:|.:.::.|:...:|.:.|.|
Fly 95 LFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQP-ASYDVRNFQLENHSIPGYLPAG 158
Fly 154 QFRT-VTEYF 162
.:|. .|.|:
Fly 159 FYRLHDTNYY 168
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33641 | NP_001027256.1 |
DUF1091 |
80..156 |
CDD:284008 |
15/66 (23%) |
CG13193 | NP_610699.1 |
DM8 |
91..183 |
CDD:214778 |
18/75 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.