DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG13193

DIOPT Version :9

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:75 Identity:18/75 - (24%)
Similarity:39/75 - (52%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAPVG 153
            |:...:|.|..||.:.::.|...::::..|:.|:...||.:. .:|.:.::.|:...:|.:.|.|
  Fly    95 LFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQP-ASYDVRNFQLENHSIPGYLPAG 158

  Fly   154 QFRT-VTEYF 162
            .:|. .|.|:
  Fly   159 FYRLHDTNYY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 15/66 (23%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.