DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG33454

DIOPT Version :10

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:32 Identity:9/32 - (28%)
Similarity:17/32 - (53%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MVKYDPGKHTFISVPYAPLKFSCLFTAALLSS 49
            :||..|..|....|.:||:..:.:.:|.::.|
  Fly    73 VVKALPVVHHAPVVHHAPVLKTVVHSAPVVHS 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:461928
CG33454NP_995887.1 DUF1091 72..148 CDD:461928 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.