DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33641 and CG30050

DIOPT Version :9

Sequence 1:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:144 Identity:35/144 - (24%)
Similarity:60/144 - (41%) Gaps:15/144 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PDIFEKMDCNLYQANNRSY---VNVEMKLKKEVSDLNVRAIMEFWKPNAQNKM-KLYDVRVDGCL 98
            |:.|..:.|.:....||:.   ||:..:|......|.|..      |||:..: :::|:..|.|.
  Fly    42 PNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSI------PNAKKVITQIFDITFDVCK 100

  Fly    99 ILRTIHKNKLFYFYVKSFKKHSNV-VLSCPFKANFTYKMDDWFLDEEELPPFAPVGQFRTVTEYF 162
            :||...:..|....|.:..|:||. ...|||...   |.:...:...:|||.....:|....::|
  Fly   101 VLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKG---KFESRNISVTDLPPMLTESEFFVNLDFF 162

  Fly   163 TQQ-RLIIRVVAHG 175
            ..: .:.:.|..||
  Fly   163 IPKVAIAMNVTLHG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 20/77 (26%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.