DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Msp300 and gas2

DIOPT Version :9

Sequence 1:NP_001188695.1 Gene:Msp300 / 3771968 FlyBaseID:FBgn0261836 Length:13540 Species:Drosophila melanogaster
Sequence 2:XP_685440.4 Gene:gas2 / 557312 -ID:- Length:334 Species:Danio rerio


Alignment Length:311 Identity:73/311 - (23%)
Similarity:106/311 - (34%) Gaps:98/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly 10390 PADEQQPPANKIKTDIQ------------SFLEAEQTLAAALKEQSSTPTGASV-AEDVQTQPEE 10441
            |...:|.||....||:|            |.|..::.||..|    |:..|..: ||....:.:.
Zfish     4 PLSSKQQPAGPGLTDLQLYSQWLASRHEASLLPMKEDLALWL----SSMLGVEISAESFMERLDN 64

  Fly 10442 IVLEERTVEISTIKTEENQQEPVIVEEVKSLPVEPEPVEPELEEVAIAIVEQTEEKPEEPVIEKQ 10506
            ..|..|..|....|..||..:  :....||:|....|                        ....
Zfish    65 GFLLCRLAETLQEKFRENSSD--VTSPGKSIPCRRIP------------------------CRAS 103

  Fly 10507 PASGPIDLRAATQLFIS-------GEAAASTAPQKTFQISAPSLEDNGAGVLKVVLGKESTNEED 10564
            .|||....|..|..|:|       ||...              .|.:|     :||.|:..    
Zfish   104 AASGTFFARDNTANFLSWCREVGVGETCL--------------FESDG-----LVLHKQQR---- 145

  Fly 10565 TAAPTTGKVSMTIIETAAAPAADAKRRRKKKKRRDTKHEEELEQEQETEPE-PVAAVKEPEVSSD 10628
                   :|.:.::|.....|     |.|.:.....|.|:|:|||:|..|| |::.|.....|..
Zfish   146 -------EVCLCLLELGRIAA-----RYKVEPPGLIKLEKEIEQEEEKLPEPPLSPVTPASYSQS 198

  Fly 10629 VPVSPEDSPRDTVRHESIVEISPDSDLSSIEIDTKVKIVEDAVVSSPSESP 10679
            .||||..||.:          ||.:..:|.:..|. |::::| |...||.|
Zfish   199 PPVSPSISPSN----------SPFNKSNSSKKSTG-KLLDEA-VKHISEDP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Msp300NP_001188695.1 SPEC 17..220 CDD:238103
SPEC 9546..9732 CDD:295325
sbcc 11187..12008 CDD:129705
SMC_prok_B 11614..12442 CDD:274008
SPEC 11994..12156 CDD:295325
SPEC 12374..12564 CDD:295325
Lipase_chap 12376..12529 CDD:281297
SPEC 12703..12923 CDD:238103
SPEC 12816..13032 CDD:295325
SPEC 13196..13374 CDD:238103
KASH 13484..13540 CDD:287506
gas2XP_685440.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.