DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and MTQ1

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_014336.1 Gene:MTQ1 / 855662 SGDID:S000005007 Length:314 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:37/164 - (22%)
Similarity:65/164 - (39%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLAGFSLCLATDINPKACNA 82
            :|..|....::.||...:.....:...:| :..:|:|.|..||:..:|..:. .|.|::.:|...
Yeast    87 WETEEWVMAIIRALNNSMLSRHTIPLHIC-DTFTGTGCIALALSHGIANCTF-TAIDVSTRAIKL 149

  Fly    83 TRRTATRN---GARL--DSIRCSLADALRPRSVDVLLFNPPYV----VTSDEELQTQQFDSH--- 135
            .:....:|   |.:|  .:|..|.|....|..:|:|..||||:    ...|.:...:.|:..   
Yeast   150 VKENMLKNKVSGGKLVQHNILSSKASDEYPSHIDILTGNPPYIRKRDFNRDVKTSVKLFEPRLAL 214

  Fly   136 -SESSTDRNLVFSWAGGQDGRRVTDILLKQLDDI 168
             .|.....|||..|.      ..||....::.|:
Yeast   215 VGELECYINLVNYWL------PKTDSFFYEIGDV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 37/164 (23%)
HemK <15..193 CDD:225443 37/164 (23%)
MTQ1NP_014336.1 hemK_fam 1..283 CDD:273125 37/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2890
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R762
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.