DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and AT3G13440

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001327233.1 Gene:AT3G13440 / 820545 AraportID:AT3G13440 Length:278 Species:Arabidopsis thaliana


Alignment Length:210 Identity:77/210 - (36%)
Similarity:108/210 - (51%) Gaps:20/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITA----LAKKLAGFSLCLATDINP 77
            ||||.:|||.|:|||..|...|....|.:|:|:|.|||.:||:    |..::.|... ||.|.||
plant    49 VYEPCDDSFALVDALLADRTNLIEHNPKICMEIGCGSGYVITSLILLLQNEVPGVHY-LAIDTNP 112

  Fly    78 KACNATRRTATRNGARLDSIRCSLADALRPR---SVDVLLFNPPYVVTSDEELQTQQFDSHSESS 139
            .|...|:.|...:|...|.|...||..|..|   ||||::.|||||.|.:.|:..:         
plant   113 IATRVTKETLEAHGVNADVICADLATGLEKRLAGSVDVIVVNPPYVPTPEYEVGME--------- 168

  Fly   140 TDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAVKFME 204
               .:..:||||::||.|.|.:|..:|.:||.:|..||:.|..|.|.||...:....:.:...::
plant   169 ---GIASAWAGGENGRTVIDKILPVVDLLLSEKGWFYLVTLTSNFPAEICLMMRKKGYASRIVVQ 230

  Fly   205 RRIPGEHLCILKVTR 219
            |....|:|.|||..|
plant   231 RSTEEENLVILKFWR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 76/208 (37%)
HemK <15..193 CDD:225443 70/182 (38%)
AT3G13440NP_001327233.1 AdoMet_MTases 46..245 CDD:388410 76/208 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4094
eggNOG 1 0.900 - - E1_COG2890
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5637
Inparanoid 1 1.050 115 1.000 Inparanoid score I2024
OMA 1 1.010 - - QHG54278
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004328
OrthoInspector 1 1.000 - - oto3541
orthoMCL 1 0.900 - - OOG6_101563
Panther 1 1.100 - - LDO PTHR45875
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3597
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.