DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and hemk1

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001107891.1 Gene:hemk1 / 560620 ZFINID:ZDB-GENE-050208-185 Length:342 Species:Danio rerio


Alignment Length:166 Identity:47/166 - (28%)
Similarity:72/166 - (43%) Gaps:30/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VELGSGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGAR-------LDSIRCSLADA 104
            :|:|.|||.|..:|.:.|....: .|.|.:..|...|...|.|.|.:       ||.::.:....
Zfish   167 LEVGCGSGAISLSLLRSLPQLRV-FALDQSQDAVCLTMENANRLGLQDRLEVHHLDVVKDADVIL 230

  Fly   105 LRPRSVDVLLFNPPYVVTSD-EELQTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDI 168
            .:...||.::.||||:::.| |.|||:.......::.|        ||.||..|...:|.....:
Zfish   231 SKCNPVDFIVSNPPYILSQDMEALQTEILGFEDHAALD--------GGSDGLFVIRPILALASKL 287

  Fly   169 LSPRGVLYL-----------LLLRENKPEEIIKYLE 193
            |:.:|.:||           .|:.|..||.|  |||
Zfish   288 LTKQGRVYLEVSSCHPPVIQQLVMETMPEFI--YLE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 47/166 (28%)
HemK <15..193 CDD:225443 45/164 (27%)
hemk1NP_001107891.1 PRK09328 65..337 CDD:236467 47/166 (28%)
AdoMet_MTases 109..299 CDD:302624 39/140 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2890
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R762
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.