DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and HEMK1

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_011532108.1 Gene:HEMK1 / 51409 HGNCID:24923 Length:355 Species:Homo sapiens


Alignment Length:158 Identity:42/158 - (26%)
Similarity:68/158 - (43%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LCVELGSGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGARL-DSIRCSLADALRPR 108
            |.:|:|.|||.|..:|..:|.. |..:|.|....|.:.|...|.|  .|| |.|.....|....|
Human   162 LILEVGCGSGAISLSLLSQLPQ-SRVIAVDKREAAISLTHENAQR--LRLQDRIWIIHLDMTSER 223

  Fly   109 S--------VDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQL 165
            |        :|:::.|||||...|.|....:..|:.:.:       :..||::|..:...:|...
Human   224 SWTHLPWGPMDLIVSNPPYVFHQDMEQLAPEIRSYEDPA-------ALDGGEEGMDIITHILALA 281

  Fly   166 DDILSPRGVLYLLLLRENKPEEIIKYLE 193
            ..:|...|.:: |.:....||.:..:|:
Human   282 PRLLKDSGSIF-LEVDPRHPELVSSWLQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 42/158 (27%)
HemK <15..193 CDD:225443 41/156 (26%)
HEMK1XP_011532108.1 RF_mod_PrmC 63..326 CDD:274634 42/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2890
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R762
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.