DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and n6amt1

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001002502.1 Gene:n6amt1 / 436775 ZFINID:ZDB-GENE-040718-206 Length:219 Species:Danio rerio


Alignment Length:208 Identity:81/208 - (38%)
Similarity:110/208 - (52%) Gaps:30/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLAGFSLCLATDINPK 78
            |..|||||||||||:||||||.:.|...:|.:|:|:|||||||...||..:...:|.:.||:|..
Zfish    15 FSEVYEPAEDSFLLMDALEKDADRLKDSRPCVCLEVGSGSGVISAFLASLIGAQALYICTDVNAD 79

  Fly    79 ACNATRRTATRNGARLDSIRCSLADALRPR---SVDVLLFNPPYVVTSDEELQTQQFDSHSESST 140
            |...:.:|:..|...:..:...|.:.|.||   .||||:||||||.|..||:     .||...: 
Zfish    80 AAQCSMQTSILNNLHVQPVVTDLVECLLPRLNGKVDVLVFNPPYVATPSEEV-----GSHGVEA- 138

  Fly   141 DRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYL--EGLQFRAVKFM 203
                  |||||..||.|.:.....:.|:||..|:.||:.:.:|.||.|:..|  .||.       
Zfish   139 ------SWAGGLHGREVMNRFFPMIPDLLSEHGLFYLVTVSDNDPEGIVDLLARSGLD------- 190

  Fly   204 ERRIPGEHLCILK 216
                  .|||:.:
Zfish   191 ------GHLCLTR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 80/207 (39%)
HemK <15..193 CDD:225443 75/182 (41%)
n6amt1NP_001002502.1 HemK <16..213 CDD:225443 80/207 (39%)
AdoMet_MTases 17..211 CDD:302624 80/206 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580470
Domainoid 1 1.000 80 1.000 Domainoid score I8572
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5637
Inparanoid 1 1.050 138 1.000 Inparanoid score I4516
OMA 1 1.010 - - QHG54278
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004328
OrthoInspector 1 1.000 - - oto39779
orthoMCL 1 0.900 - - OOG6_101563
Panther 1 1.100 - - LDO PTHR45875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3597
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.