DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and HemK1

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001260134.1 Gene:HemK1 / 33902 FlyBaseID:FBgn0031817 Length:323 Species:Drosophila melanogaster


Alignment Length:221 Identity:60/221 - (27%)
Similarity:95/221 - (42%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SPEDFEHVYEPAEDSF--LLLDALEKDLEYLDRLQPSLCVELGSGSG------------VIITAL 60
            ||..|  :..|..:.|  |::|. .|:.:::|.|      |:|.|||            |:.||:
  Fly   120 SPSVF--IPRPETEEFMRLVIDD-HKNAKHVDLL------EVGCGSGAMSLSMLHSLPQVVATAI 175

  Fly    61 AKKLAGFSLCLATDINPKACNATRRTATRNGARLDSIRCSLADALRPRSVDVLLFNPPYVVTSDE 125
            .:..|  :..||.: |.|......|....|....:.  ..|.:||:.:..|:::.|||||.|  |
  Fly   176 ERSKA--ATVLAAE-NAKMLGLLNRFEVHNHTMEED--KYLPEALKDKKYDLIISNPPYVKT--E 233

  Fly   126 ELQTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKP----- 185
            |.|.    .|.|.....|| .:..||.||.||..::.......|.|.|.|:|.|..::.|     
  Fly   234 EFQF----LHPEVVVYENL-NALDGGSDGLRVARLVFDLACRHLRPGGKLWLELGNDHPPMVKTI 293

  Fly   186 -----EEIIKYLEGL--QFRAVKFME 204
                 |..:|::.|.  |::..:|::
  Fly   294 MNLKYEGRLKFIAGYSDQYQRERFVQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 57/216 (26%)
HemK <15..193 CDD:225443 54/201 (27%)
HemK1NP_001260134.1 PRK09328 61..322 CDD:236467 60/221 (27%)
AdoMet_MTases 84..288 CDD:302624 54/188 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2890
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R762
SonicParanoid 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.