DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and Hemk1

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001100323.1 Gene:Hemk1 / 300989 RGDID:1308293 Length:340 Species:Rattus norvegicus


Alignment Length:182 Identity:43/182 - (23%)
Similarity:74/182 - (40%) Gaps:31/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LCVELGSGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGARLDSIRCSLADA----- 104
            |.:|:|.|||.|..:|..:|....: :|.|....|.:.|...|.|...: |.||....|.     
  Rat   163 LILEVGCGSGAIALSLLSQLPKTQV-IAVDKEEAAVSLTLENAQRLQLQ-DRIRIIHLDITSEGC 225

  Fly   105 ---LRP-RSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQL 165
               |.| ..:|:::.||||:...|.|....:..|:.:       :.:..||.:|..:...:|...
  Rat   226 CTHLLPWGPMDLVVSNPPYIFRKDMEQLAPEIRSYED-------LVALDGGDEGMDIITHILTLA 283

  Fly   166 DDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAVKFMERRIPGEHLCILKV 217
            ..:|:..|.:: |.:....||.:..:|:..            |..||.::.|
  Rat   284 PWLLNASGSIF-LEVDPRHPELVSSWLQSQ------------PDLHLSLVGV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 43/182 (24%)
HemK <15..193 CDD:225443 38/156 (24%)
Hemk1NP_001100323.1 RF_mod_PrmC 64..333 CDD:274634 43/182 (24%)
AdoMet_MTases 91..300 CDD:302624 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2890
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.