DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HemK2 and mtq-2

DIOPT Version :9

Sequence 1:NP_001027221.1 Gene:HemK2 / 3771966 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_494209.2 Gene:mtq-2 / 173575 WormBaseID:WBGene00016341 Length:221 Species:Caenorhabditis elegans


Alignment Length:202 Identity:86/202 - (42%)
Similarity:116/202 - (57%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLAGFSLCLATDINPKACN 81
            |||||||:|||:||:|||::.:....|.|.:|:|.||||:.|.:.:.|.|....:|||:||.|.:
 Worm    18 VYEPAEDTFLLIDAIEKDIKEIRSRDPKLVLEIGCGSGVVSTFVNQALGGNVTSVATDLNPHALD 82

  Fly    82 ATRRTATRNGARLDSIRCSLADALRP--RSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNL 144
            .|..||..|..::|.:|..|...|..  ..|||||||||||.| |||.::             |:
 Worm    83 VTLETAKLNDIKIDVVRTDLFAGLENLLGKVDVLLFNPPYVPT-DEEPKS-------------NI 133

  Fly   145 VFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAVKFMERRIPG 209
            ..::|||:.||...|.||.::.::||||||.||:.|..|....::|. ...|......||||...
 Worm   134 ELTYAGGRTGRSTLDRLLPRVPELLSPRGVFYLVALHSNDIPALLKE-HSEQMTVSVSMERRCGI 197

  Fly   210 EHLCILK 216
            |||.|||
 Worm   198 EHLYILK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 86/202 (43%)
HemK <15..193 CDD:225443 75/177 (42%)
mtq-2NP_494209.2 AdoMet_MTases 17..207 CDD:388410 86/202 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159185
Domainoid 1 1.000 83 1.000 Domainoid score I5377
eggNOG 1 0.900 - - E1_COG2890
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5637
Inparanoid 1 1.050 138 1.000 Inparanoid score I3113
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54278
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004328
OrthoInspector 1 1.000 - - oto18505
orthoMCL 1 0.900 - - OOG6_101563
Panther 1 1.100 - - LDO PTHR45875
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R762
SonicParanoid 1 1.000 - - X3597
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.