DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and ASMTL

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_004183.2 Gene:ASMTL / 8623 HGNCID:751 Length:621 Species:Homo sapiens


Alignment Length:223 Identity:93/223 - (41%)
Similarity:125/223 - (56%) Gaps:20/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLAPIKHLLGNYRIVLASGSPRRQELVKMLGLNAELCPSTFEENLNLEDFKEFSDYIEATALGKA 65
            :|.|:...|.:.|:||||.||||||::...||..|:.||.|:|.|:...|.....|...||..||
Human     2 VLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKASFATPYGYAMETAKQKA 66

  Fly    66 EEVYSRLRSTGDSKNL----IVIAADTMVTLGKEIYGKPKDPADAIRMLTNLSGTSNRVFTGVVL 126
            .||.:||.    .|:|    :||.|||:||:|..|..||.|..||.|||:.|||..:.|||||.:
Human    67 LEVANRLY----QKDLRAPDVVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAI 127

  Fly   127 KHANG--------IRKFTDTADVYFGDLLPEQIQSYVDSGDPLDKAGAYGVQGPAGALIHRIDGD 183
            .|.:.        :.:|.:...|.|.:|..|.:..||.||:|:||||.||:|...|.|:..:.||
Human   128 VHCSSKDHQLDTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGD 192

  Fly   184 FYCVMGLPLHRLCCELNKLFL----EDL 207
            |..|:|.||:..|.:|.||:.    |||
Human   193 FLNVVGFPLNHFCKQLVKLYYPPRPEDL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 83/196 (42%)
ASMTLNP_004183.2 MAF-like 11..223 90/214 (42%)
Maf 15..208 CDD:238310 83/196 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..279
ASMT-like 277..621
dimerization2 287..371 CDD:374853
AdoMet_MTases 388..599 CDD:388410
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 508..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4644
eggNOG 1 0.900 - - E1_COG0424
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H36273
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001706
OrthoInspector 1 1.000 - - oto88758
orthoMCL 1 0.900 - - OOG6_101328
Panther 1 1.100 - - LDO PTHR43213
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16714
SonicParanoid 1 1.000 - - X343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.