DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and AT5G66550

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001331356.1 Gene:AT5G66550 / 836787 AraportID:AT5G66550 Length:238 Species:Arabidopsis thaliana


Alignment Length:204 Identity:55/204 - (26%)
Similarity:95/204 - (46%) Gaps:16/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YRIVLASGSPRRQELVKMLGLNAELCPSTFEENLNLEDFKEFSDYIEATALGKAEEVYSRL---- 72
            ::::|.|.|..|:.::..:|.:..:..:..:|.....:..|  |.:.|.|..||.|:.|:|    
plant    41 FKLILGSQSMARKRILAEMGYDYTIVTADIDEKAIRTEKPE--DLVVALAEAKANEIISKLGGES 103

  Fly    73 RSTGDSKNLIVIAADTMVTLGKEIYGKPKDPADAIRMLTNLSGTSNRVFTGVVLKH-ANGIRK-F 135
            :...|.:..::|.|||:|.....|..||....:|...:...||:...|...|:::: ..|::| .
plant   104 QFAKDPQPTLLITADTVVVYKGVIREKPTTKEEAREFIKGYSGSHGGVVGSVLVRNLKTGVKKGG 168

  Fly   136 TDTADVYFGDLLPEQ-IQSYVDSGDPLDKAGAYGVQGP-AGALIHRIDGDFYCVMGLPLHRLCCE 198
            .|.|:|||.: :||| |...:|.......||...::.| ....|..:.|....|||||.     |
plant   169 WDKAEVYFHE-IPEQVIDGLIDDAITYKVAGGLTLEHPLISPFIDSVVGGVDTVMGLPK-----E 227

  Fly   199 LNKLFLEDL 207
            |.:.|:.|:
plant   228 LTEKFINDV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 51/192 (27%)
AT5G66550NP_001331356.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4117
eggNOG 1 0.900 - - E1_COG0424
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2571
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322992at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto4181
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.