DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and AT5G42770

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001190455.1 Gene:AT5G42770 / 834287 AraportID:AT5G42770 Length:233 Species:Arabidopsis thaliana


Alignment Length:233 Identity:52/233 - (22%)
Similarity:96/233 - (41%) Gaps:41/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NYRIVLASGSPRRQELVKMLGLNAELCPSTFEENLNLEDFKEFSDYIEATALGKAEEVYSRLR-- 73
            :::::|.|.|..|::::..:|....|..:..:|....::..|  :.:.|.|..||:.:.|:|:  
plant     7 HFKLILGSSSIARRKILTDMGYQFTLMSADIDEKSIRKEKPE--ELVLALAEAKADAIVSKLQIS 69

  Fly    74 ----------------------------STGDSKNLIVIAADTMVTLGKEIYGKPKDPADAIRML 110
                                        :..:.|:.::|..|.:|.....:..||....:|...:
plant    70 ECEDEEQPRVLIASDTAEAIMQRIPDGENIEEDKSTLLITCDQVVVYEDAVREKPSSVEEAREYI 134

  Fly   111 TNLS-GTSNRVFTGVVLKHANGIRK-FTDTADVYFGDLLPEQIQSYVDSGDPLDKAGAYGVQGP- 172
            ...| |.:..|.:..|.....|:|| ..|..::||.::..|.|:..::.|..|..|||..::.| 
plant   135 RGYSKGHTATVSSVAVTNLKTGVRKGGVDRVEIYFNEIPEETIEKLIEEGMVLKVAGALLIEHPL 199

  Fly   173 AGALIHRIDGDFYCVMGLPLHRLCCEL-NKLFLEDLSS 209
            ....:..:.|....|||||.     || .||..|.|:|
plant   200 ILPCVKEVVGTTDSVMGLPK-----ELTEKLIKEVLAS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 45/217 (21%)
AT5G42770NP_001190455.1 Maf 10..229 CDD:396891 49/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4117
eggNOG 1 0.900 - - E1_COG0424
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2571
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322992at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.830

Return to query results.
Submit another query.