DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and asmt2

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001103947.1 Gene:asmt2 / 568256 ZFINID:ZDB-GENE-070410-45 Length:348 Species:Danio rerio


Alignment Length:237 Identity:49/237 - (20%)
Similarity:86/237 - (36%) Gaps:64/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGNYRIVLASGSP-RRQELVKMLGLNAELCPSTFEENLNLEDFKEFSD--YIEATALGKAEEV-- 68
            ||.:.::|.|..| ...|:.:.||.:.:    ..|..|:|....|..|  .::..||..:.:|  
Zfish    35 LGVFDLLLQSQKPLSAAEVAEQLGTSQD----GIERLLDLMVAIEIVDVEVVQGNALYSSTDVAN 95

  Fly    69 -YSRLRSTGDSKNLIVIAADTMVTLGKEIYGKPKDPADAIRMLTNLSG-----TSNRVFTGV--- 124
             |....|.....:||:.::.|:..|...:       .||:|...|.:.     .|..:|:.:   
Zfish    96 LYLAKSSPKSLHDLIIYSSQTIYPLWNNL-------VDAVREGKNQNEKTFGLPSEEIFSAIYRS 153

  Fly   125 ---VLKHANGIRKFT---DTADVYFG-DLLPEQIQSYVDSGDPLDKAGAYGVQGPAGALIHRIDG 182
               :||.. |:...|   |..|:... ||  ...:|.:|.|            |.:|||...:..
Zfish   154 EEEMLKFM-GLMNSTWVIDGHDIVTAFDL--SSFKSVIDLG------------GCSGALARELAK 203

  Fly   183 DF----YCVMGLPL-------------HRLCCELNKLFLEDL 207
            ::    ..|:.||.             ..:|.:....|.|::
Zfish   204 EYPSSSVTVLDLPSVVQTAQRHFAQQDDTICFQAGDFFEEEI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 45/222 (20%)
asmt2NP_001103947.1 Dimerisation2 15..104 CDD:293469 18/72 (25%)
C20_methyl_CrtF 29..334 CDD:131763 49/237 (21%)
AdoMet_MTases 109..334 CDD:302624 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.