DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and asmt

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:XP_012812327.1 Gene:asmt / 496888 XenbaseID:XB-GENE-942483 Length:344 Species:Xenopus tropicalis


Alignment Length:173 Identity:34/173 - (19%)
Similarity:55/173 - (31%) Gaps:75/173 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCPSTFEENLNLEDFKEFSDYIEATALGKAEEVYSRLRSTGDSKNLIVIAADTMVTLGKEIYGKP 100
            :|........:|..|||..|      :|..        |.|.:|:.:.:...:.||:        
 Frog   167 ICGKDVLAAFDLSSFKEICD------IGGC--------SGGLAKHFLSLYPSSSVTI-------- 209

  Fly   101 KDPADAIRMLTNLSGTSNRVFTGVVLKHANGIRKFTDTADVYF--GDLLPEQIQSYVDSGDPLDK 163
            .|..:.::|               ..||      |....|:.|  ||..          .|||.:
 Frog   210 MDLPEVVQM---------------AKKH------FITDGDIVFLEGDFF----------NDPLPE 243

  Fly   164 AGAYGVQGPAGALIHRIDGDF---YCVMGLPLHRLCCELNKLF 203
            :..|        ::.||..|:   .|:      ||   |||::
 Frog   244 SDLY--------ILARIIHDWTEDKCL------RL---LNKIY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 31/167 (19%)
asmtXP_012812327.1 dimerization2 12..100 CDD:374853
Methyltransf_2 118..326 CDD:366359 34/173 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001706
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.