DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and asmtl

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_998676.1 Gene:asmtl / 324134 ZFINID:ZDB-GENE-030131-2854 Length:632 Species:Danio rerio


Alignment Length:215 Identity:85/215 - (39%)
Similarity:118/215 - (54%) Gaps:17/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LAPIKHLLGNYRIVLASGSPRRQELVKMLGLNAELCPSTFEENLNLEDFKEFSDYIEATALGKAE 66
            |.|:...|....:||||.||||.|::...||..|:.||.|:|.|:...||...:|...||..||.
Zfish     3 LNPVISKLSGKLVVLASASPRRLEILSNAGLRFEVVPSWFKETLDKSLFKHPCEYAVETAKQKAL 67

  Fly    67 EVYSRL----RSTGDSKNLIVIAADTMVTLGKEIYGKPKDPADAIRMLTNLSGTSNRVFTGVVL- 126
            ||..|:    ..|.|    ||:.|||:||:...|..||.|..||.|||:.|||..:.|||||.: 
Zfish    68 EVAQRMPFKHLKTPD----IVVGADTVVTVDGLILEKPTDKQDAYRMLSRLSGKEHSVFTGVAIV 128

  Fly   127 ----KHAN----GIRKFTDTADVYFGDLLPEQIQSYVDSGDPLDKAGAYGVQGPAGALIHRIDGD 183
                |:::    .:..|.:...|.|.:|..|.:..|::||:|:||||.||:|...|.|:..:.||
Zfish   129 ICRDKNSSVTDYKVVDFYEETKVKFAELSEEMLWEYINSGEPMDKAGGYGIQALGGMLVEYVRGD 193

  Fly   184 FYCVMGLPLHRLCCELNKLF 203
            |..|:|.||:..|.:|..:|
Zfish   194 FLNVVGFPLNHFCKQLGSIF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 80/197 (41%)
asmtlNP_998676.1 Maf 15..209 CDD:238310 80/197 (41%)
Dimerisation2 279..365 CDD:293469
AdoMet_MTases 383..590 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5092
eggNOG 1 0.900 - - E1_COG0424
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H36273
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001706
OrthoInspector 1 1.000 - - oto39594
orthoMCL 1 0.900 - - OOG6_101328
Panther 1 1.100 - - LDO PTHR43213
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.