DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and SPAC3G6.03c

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_594969.2 Gene:SPAC3G6.03c / 2543209 PomBaseID:SPAC3G6.03c Length:241 Species:Schizosaccharomyces pombe


Alignment Length:196 Identity:76/196 - (38%)
Similarity:108/196 - (55%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGNYRIVLASGSPRRQELVKMLGL-NAELCPSTFEENLNLEDFKEFSDYIEATALGKAEEVYSRL 72
            |.:.||:||||||||::|.:.:|. |.|.|.|.|.|:||...:....:|...|::.||..||.:|
pombe    27 LKDKRIILASGSPRRKQLFEQMGFPNVETCVSGFPEDLNKSMYITPWEYAADTSVQKAIAVYEKL 91

  Fly    73 RSTGDSKNLIVIAADTMVTLGKEIYGKPKDPADAIRMLTNL--SGTSNRVFTGV-------VLKH 128
            .:..||.: ||::|||::.|..||..||.||...:.||..|  |.|.::|||.|       |..|
pombe    92 AAEEDSPD-IVVSADTILILDSEIMEKPNDPKHHLAMLKKLRNSKTPHKVFTAVSVIVPMEVPIH 155

  Fly   129 ANGIRK--FTDTADVYFGDLLPEQIQSYVDSGDPLDKAGAYGVQGPAGALIHRIDGDFYCVMGLP 191
            ...:.|  ..:|...:...:..|.:::||..|:..||||.|.:||....||..|.|||..|:|||
pombe   156 PGYVMKTHLEETQVKFDPSITDEFLEAYVRCGEGSDKAGGYAIQGHGALLIESIIGDFSNVVGLP 220

  Fly   192 L 192
            :
pombe   221 I 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 74/191 (39%)
SPAC3G6.03cNP_594969.2 Maf 32..227 CDD:238310 74/191 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 109 1.000 Domainoid score I1616
eggNOG 1 0.900 - - E1_COG0424
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H36273
Inparanoid 1 1.050 109 1.000 Inparanoid score I1581
OMA 1 1.010 - - QHG61548
OrthoFinder 1 1.000 - - FOG0001706
OrthoInspector 1 1.000 - - oto100658
orthoMCL 1 0.900 - - OOG6_101328
Panther 1 1.100 - - LDO PTHR43213
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16714
SonicParanoid 1 1.000 - - X343
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.