DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9515 and Asmt

DIOPT Version :9

Sequence 1:NP_001027233.1 Gene:CG9515 / 3771965 FlyBaseID:FBgn0032077 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001186141.1 Gene:Asmt / 107626 MGIID:96090 Length:387 Species:Mus musculus


Alignment Length:114 Identity:28/114 - (24%)
Similarity:42/114 - (36%) Gaps:17/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EATALGKAEEVYSRLRSTGDSKNLIVIAADTMVTLG---KEIYGKPKDPADAIRMLTNLSGTSNR 119
            :|.|||..:.. :..||:|.|.....:..|....||   :.....|:.||     .||....|..
Mouse    41 DAAALGPVDAA-ALARSSGLSPRGTRLLLDACAGLGLLRRRRGAGPRGPA-----YTNSPLASTF 99

  Fly   120 VFTGVVLKHANGIRKFTDTADVYFGDL---LPEQIQSY-----VDSGDP 160
            :..|..|...:.:.....|..:.:|.|   :.|....|     ||:.||
Mouse   100 LVAGSPLSQRSLLLYLAGTTYLCWGHLADGVREGRSQYARAVGVDADDP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9515NP_001027233.1 Maf 14..199 CDD:238310 28/114 (25%)
AsmtNP_001186141.1 Dimerisation2 18..105 CDD:297920 18/69 (26%)
Methyltransf_2 111..338 CDD:279263 9/38 (24%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01020 246..248
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..387
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.