DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment waw and eIF2gamma

DIOPT Version :9

Sequence 1:NP_001027089.1 Gene:waw / 3771960 FlyBaseID:FBgn0024182 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster


Alignment Length:363 Identity:75/363 - (20%)
Similarity:123/363 - (33%) Gaps:138/363 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NFSIIAHVDHGKSTLADRLLELTGAIARNGGQHQVLDNLQVERERGITVKA--QTASIFH----- 158
            |...|.||.|||||:..         |.:|.|.....|   |.||.||:|.  ..|.|:.     
  Fly    42 NIGTIGHVAHGKSTVVK---------AISGVQTVRFKN---ELERNITIKLGYANAKIYKCDNPK 94

  Fly   159 --------------------------------RHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDG 191
                                            ||      ::.:|.|||......:....|..|.
  Fly    95 CPRPASFVSDASSKDDSLPCTRLNCSGNFRLVRH------VSFVDCPGHDILMATMLNGAAVMDA 153

  Fly   192 VVLLV---DACHGVQAQTVANYHLA-----KQRQLAVVPVLNKID-IKHANPDQVCQDL-KLLFG 246
            .:||:   ::|  .|.||  :.|||     |.:|:.::.  |||| ||.:...:..::: |.:.|
  Fly   154 ALLLIAGNESC--PQPQT--SEHLAAIEIMKLKQILILQ--NKIDLIKESQAKEQYEEITKFVQG 212

  Fly   247 --IDPDEVLRVSAKLGTGVSEVLERVIETVP-PPQVQRDSDFRALIFDSWFDKYRGALNLIYVLN 308
              .:...::.:||:|...:..:.|.::..:| ||:     ||.                      
  Fly   213 TVAEGAPIIPISAQLKYNIDVLCEYIVNKIPVPPR-----DFN---------------------- 250

  Fly   309 GKLEQNQDIQSLATKKVYSVKSISVLRPAECPVPDVSAGQVGLIACNMRNSKESIVGDTIHLKNQ 373
                        |..::..::|..|.:|. |.|.|:..|..|          .||:...:.:..:
  Fly   251 ------------APPRLIVIRSFDVNKPG-CEVADLKGGVAG----------GSILSGVLKVGQE 292

  Fly   374 AVAAAGSYRPQQPLVFAGVFPADQSKHVALRSAIDKMV 411
            .     ..||       ||...|...::..|....::|
  Fly   293 I-----EVRP-------GVVTKDSDGNITCRPIFSRIV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wawNP_001027089.1 PRK05433 94..695 CDD:235462 75/363 (21%)
LepA 100..277 CDD:206677 53/227 (23%)
EF4_II 285..370 CDD:293900 12/84 (14%)
EF4_III 386..461 CDD:293917 5/26 (19%)
lepA_C 502..581 CDD:239680
LepA_C 589..695 CDD:283959
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 75/363 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.