DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment waw and CG33158

DIOPT Version :9

Sequence 1:NP_001027089.1 Gene:waw / 3771960 FlyBaseID:FBgn0024182 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster


Alignment Length:446 Identity:118/446 - (26%)
Similarity:193/446 - (43%) Gaps:112/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ERIRNFSIIAHVDHGKSTLADRLLELTGAIA-RNGGQHQVLDNLQVERERGITVKAQTASIFHRH 160
            :::||..|:|||||||:||||.|:...|.|: |..|:.:.|||...|:|||||:|:.:.|::::.
  Fly    17 QQVRNICILAHVDHGKTTLADSLVASNGIISQRMAGKLRYLDNRSDEQERGITMKSSSISLYYQE 81

  Fly   161 KGQL-----YLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHGVQAQTVANYHLAKQRQLAV 220
            ..::     ||:||||:|||||||:|||.::..|||.:::||...||..||.|......:.||..
  Fly    82 AEEMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVGPQTRACLRQIYEEQLKP 146

  Fly   221 VPVLNKID----IKHANP----DQVCQDLKLLFGIDPDEVLRVSAKLGT-GVSEVL--------- 267
            |.||||:|    .|..:|    ..:||.|:           :|:|.||: ..|::|         
  Fly   147 VLVLNKLDRLILEKQMDPLDAYFHLCQVLE-----------QVNAVLGSIFASDILAKEDITKKD 200

  Fly   268 --ERVIETVPPPQVQRDSDFRALIFDSWFDKYRGALNLIYVLNGKLEQNQDIQSLATKKVYSVKS 330
              |..:|.|...::........:||.|.:|.:                           .:||: 
  Fly   201 NYESALEEVDDSELYFSPSSGNVIFCSAYDGW---------------------------AFSVR- 237

  Fly   331 ISVLRPAECPVPDVSAGQVGLIACNMRNSKESIVGDTIHLKNQAVAAAGSY-RPQQPLVFAGVFP 394
                        |.:|.....:..:.::.:..:.||..:...:..|..|:. :.::|:....|..
  Fly   238 ------------DFAAMYAKRLEMSRKDLENVLWGDFYYNSKKKEALPGAQEKAKKPMFVQFVLE 290

  Fly   395 ADQSKH--VALRSAID-----------KMVLNDSAVT-VKIDSSPALGQGWRLGFLGLLHMEVFC 445
            ...|.:  :|:|...|           |:...|..:| .|:.....||| |......:|||.:  
  Fly   291 NIWSLYDIIAIRKDKDKLPGIAEKLGLKLATRDLRLTDPKLQIKAVLGQ-WLPIDKSVLHMVI-- 352

  Fly   446 QRLEQEHGAEPIITAPSVTYRLVLSNPKMIKQQGRDTMDISNAALFPEPHSIKEYY 501
                 :|...|...:.....||:..          ..:|:|  :|.||...:||.:
  Fly   353 -----QHVPPPHKISDERAQRLLYP----------ANVDLS--SLPPETLELKESF 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wawNP_001027089.1 PRK05433 94..695 CDD:235462 118/446 (26%)
LepA 100..277 CDD:206677 78/202 (39%)
EF4_II 285..370 CDD:293900 10/84 (12%)
EF4_III 386..461 CDD:293917 19/88 (22%)
lepA_C 502..581 CDD:239680 118/446 (26%)
LepA_C 589..695 CDD:283959
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 118/446 (26%)
EF2 20..249 CDD:206672 86/279 (31%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.