DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment waw and eEF1alpha1

DIOPT Version :9

Sequence 1:NP_001027089.1 Gene:waw / 3771960 FlyBaseID:FBgn0024182 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster


Alignment Length:366 Identity:86/366 - (23%)
Similarity:136/366 - (37%) Gaps:105/366 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 MPVERIR-NFSIIAHVDHGKSTLADRLLELTGAI-----------ARNGGQHQ-----VLDNLQV 141
            |..|:|. |..:|.|||.||||....|:...|.|           |:..|:..     |||.|:.
  Fly     1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 65

  Fly   142 ERERGITV-----KAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201
            |||||||:     |.:||.         |.:.:||.|||.||...:....:..|..||:|.|..|
  Fly    66 ERERGITIDIALWKFETAK---------YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 121

  Fly   202 -VQAQTVANYHLAKQRQLA-------VVPVLNKID-----IKHANPDQVCQDLKLL---FGIDP- 249
             .:|....|....:...||       ::..:||:|     ...|..:::.:::...   .|.:| 
  Fly   122 EFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPA 186

  Fly   250 ------------DEVL------------RVSAKLGTGVSEVLERVIETVPPPQVQRDSDFRALIF 290
                        |.:|            :|..|.|....:.|...::.:.||....|...|..:.
  Fly   187 AVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDAILPPARPTDKALRLPLQ 251

  Fly   291 DSWFDKYRGALNLIYVLNGKLEQNQDIQSLATKKVYSVKSISVLRPAECPV--PDVSAGQVGLIA 353
            |            :|.:.|          :.|..|..|:: .||:|....|  |.....:|..:.
  Fly   252 D------------VYKIGG----------IGTVPVGRVET-GVLKPGTVVVFAPANITTEVKSVE 293

  Fly   354 CNMRNSKESIVGDTI--HLKNQAVA------AAGSYRPQQP 386
            .:....:|::.||.:  ::||.:|.      .||..:...|
  Fly   294 MHHEALQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKANPP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wawNP_001027089.1 PRK05433 94..695 CDD:235462 86/366 (23%)
LepA 100..277 CDD:206677 58/239 (24%)
EF4_II 285..370 CDD:293900 16/88 (18%)
EF4_III 386..461 CDD:293917 1/1 (100%)
lepA_C 502..581 CDD:239680
LepA_C 589..695 CDD:283959
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 86/366 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.