DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33806 and AT1G75600

DIOPT Version :9

Sequence 1:NP_001027289.1 Gene:His3:CG33806 / 3771959 FlyBaseID:FBgn0053806 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_177690.1 Gene:AT1G75600 / 843895 AraportID:AT1G75600 Length:136 Species:Arabidopsis thaliana


Alignment Length:136 Identity:126/136 - (92%)
Similarity:131/136 - (96%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||.||||||..|||||||||||.|||||||||||||||||||||:|||||||||||
plant     1 MARTKQTARKSHGGKAPRTLLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||:||||||||.||:|||||:|||||||||||||||||||||||||||:|||||
plant    66 LPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARR 130

  Fly   131 IRGERA 136
            ||||||
plant   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33806NP_001027289.1 PTZ00018 1..136 CDD:185400 124/134 (93%)
AT1G75600NP_177690.1 PTZ00018 1..136 CDD:185400 124/134 (93%)
Histone 1..132 CDD:278551 120/130 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.