DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33806 and h3-3a

DIOPT Version :9

Sequence 1:NP_001027289.1 Gene:His3:CG33806 / 3771959 FlyBaseID:FBgn0053806 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001005101.1 Gene:h3-3a / 448680 XenbaseID:XB-GENE-6042439 Length:136 Species:Xenopus tropicalis


Alignment Length:136 Identity:132/136 - (97%)
Similarity:135/136 - (99%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
 Frog     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|:.|||||||||||||||||||||||||||||||||||||||
 Frog    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
 Frog   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33806NP_001027289.1 PTZ00018 1..136 CDD:185400 130/134 (97%)
h3-3aNP_001005101.1 PTZ00018 1..136 CDD:185400 130/134 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R543
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.