DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33806 and H3-7

DIOPT Version :10

Sequence 1:NP_001027289.1 Gene:His3:CG33806 / 3771959 FlyBaseID:FBgn0053806 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001342338.1 Gene:H3-7 / 440686 HGNCID:32060 Length:136 Species:Homo sapiens


Alignment Length:100 Identity:22/100 - (22%)
Similarity:37/100 - (37%) Gaps:27/100 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CSSSLNTVI------------QRCDNKISFAR---QASSEQ---GFFMRPASPD--------DVL 75
            |.||...||            ..|.|:....|   |.:::|   ...:|...||        |..
Human   530 CDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHW 594

  Fly    76 ENLGMNLKNTVVRRGDNR-LYFARQASSAQGFFMR 109
            ::..::.||..::||..: |..|....:..|.|::
Human   595 DSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIK 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33806NP_001027289.1 PTZ00018 1..136 CDD:185400 22/99 (22%)
H3-7NP_001342338.1 PTZ00018 1..136 CDD:185400
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.