powered by:
Protein Alignment His3:CG33806 and his-73
DIOPT Version :9
Sequence 1: | NP_001027289.1 |
Gene: | His3:CG33806 / 3771959 |
FlyBaseID: | FBgn0053806 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001366902.1 |
Gene: | his-73 / 41657024 |
WormBaseID: | WBGene00001947 |
Length: | 46 |
Species: | Caenorhabditis elegans |
Alignment Length: | 46 |
Identity: | 44/46 - (95%) |
Similarity: | 45/46 - (97%) |
Gaps: | 0/46 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 MALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
||||||:|||||||.|||||||||||||||||||||||||||||||
Worm 1 MALQEAAEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 46
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
His3:CG33806 | NP_001027289.1 |
PTZ00018 |
1..136 |
CDD:185400 |
42/44 (95%) |
his-73 | NP_001366902.1 |
H4 |
<1..46 |
CDD:419976 |
42/44 (95%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1745 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.