DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33806 and AgaP_AGAP007508

DIOPT Version :9

Sequence 1:NP_001027289.1 Gene:His3:CG33806 / 3771959 FlyBaseID:FBgn0053806 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_564748.3 Gene:AgaP_AGAP007508 / 3290384 VectorBaseID:AGAP007508 Length:253 Species:Anopheles gambiae


Alignment Length:138 Identity:51/138 - (36%)
Similarity:71/138 - (51%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ARTKQTARKSTGGKAPRKQLATKAARKSAPA--TGGVKKPHRYRPG-----TVALREIRRYQKST 59
            ::..:.:|.||  :.|.:.:|:.:.|:|..|  .||.......||.     ...|:|:.|.|.|.
Mosquito   117 SQRNRRSRSST--RTPSEPVASTSQRRSVSAGPPGGGSTSQNVRPNRKPRIAPLLKEMLRLQLSW 179

  Fly    60 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD 124
            ..||.|..|.|||||:   |....|....|:.||.||:|.:||.||||...|.:|..|||:.|||
Mosquito   180 HHLIPKASFGRLVREL---FDHRYRITPQALEALHEATEVFLVQLFEDAYKCCLHRARVTLAPKD 241

  Fly   125 IQLARRIR 132
            |:|...:|
Mosquito   242 IELVIILR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33806NP_001027289.1 PTZ00018 1..136 CDD:185400 51/138 (37%)
AgaP_AGAP007508XP_564748.3 Histone 136..249 CDD:278551 45/115 (39%)
H4 169..249 CDD:304892 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.