DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33806 and his-70

DIOPT Version :9

Sequence 1:NP_001027289.1 Gene:His3:CG33806 / 3771959 FlyBaseID:FBgn0053806 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_497812.2 Gene:his-70 / 184006 WormBaseID:WBGene00001944 Length:134 Species:Caenorhabditis elegans


Alignment Length:135 Identity:105/135 - (77%)
Similarity:118/135 - (87%) Gaps:2/135 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||.|||||.|||||||.||||||||..|..|.|||  ||||.:.||:|||:||||||||:||
 Worm     1 MARTKHTARKSFGGKAPRKSLATKAARKVFPVDGQVKK--RYRPSSNALKEIRKYQKSTELLVRK 63

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||:||:...::||||:|:.||.||:||||:||||||||||||||||||||||:|||||
 Worm    64 LPFQRLVREVAQEIMPNVRFQSAAIQALHEAAEAYLIGLFEDTNLCAIHAKRVTIMPKDMQLARR 128

  Fly   131 IRGER 135
            |||||
 Worm   129 IRGER 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33806NP_001027289.1 PTZ00018 1..136 CDD:185400 105/135 (78%)
his-70NP_497812.2 H4 1..133 CDD:304892 103/133 (77%)
Histone 1..130 CDD:278551 100/130 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.