DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33806 and his-72

DIOPT Version :9

Sequence 1:NP_001027289.1 Gene:His3:CG33806 / 3771959 FlyBaseID:FBgn0053806 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001255162.1 Gene:his-72 / 176660 WormBaseID:WBGene00001946 Length:151 Species:Caenorhabditis elegans


Alignment Length:109 Identity:21/109 - (19%)
Similarity:37/109 - (33%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PRKQLATKAARKSAPATGGVKKPHRYRPGTVALREI----------RRYQKSTELLIRKLPFQRL 71
            |.::...:::....|....::.|...|...|.::|:          .|...|:...:..:.|.||
 Worm    16 PPEERLQESSWPPRPPANRLQPPEESRSHIVTVQELSLSVRFVVTRSRLSFSSASFLSNVSFVRL 80

  Fly    72 VREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFED---TNLCA 112
            .|        ..|..|::.....|.|..:|.....|   |..||
 Worm    81 PR--------TSRLISASSRLPSELSRRHLKHTSSDSSRTPTCA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33806NP_001027289.1 PTZ00018 1..136 CDD:185400 21/109 (19%)
his-72NP_001255162.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R543
SonicParanoid 1 1.000 - - X183
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.