DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33806 and zgc:162611

DIOPT Version :9

Sequence 1:NP_001027289.1 Gene:His3:CG33806 / 3771959 FlyBaseID:FBgn0053806 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001082986.2 Gene:zgc:162611 / 100037365 ZFINID:ZDB-GENE-070410-87 Length:556 Species:Danio rerio


Alignment Length:74 Identity:14/74 - (18%)
Similarity:27/74 - (36%) Gaps:23/74 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KSTGGKAPRKQ-----------LATKAARKSA------PATGGVKKPHRYRPGTVALREIRRYQK 57
            |..|||...|:           ::.:...:|:      |.:|.:.:.|....|..|..:.::.. 
Zfish   456 KEQGGKLTHKKFMDQLIEELCSVSEEVPEQSSIQVEHLPVSGALLESHTATTGRQACSQCKKQD- 519

  Fly    58 STELLIRKL 66
                 ||:|
Zfish   520 -----IRQL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33806NP_001027289.1 PTZ00018 1..136 CDD:185400 14/74 (19%)
zgc:162611NP_001082986.2 DDE_Tnp_1_7 98..452 CDD:290555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.