DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG14518

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:131 Identity:41/131 - (31%)
Similarity:67/131 - (51%) Gaps:5/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVNIKCTCYEKSFCELKRCELKVLGRGIVGLFLHAQAHQL-PINSSTCILSLYRRFNGYRPFLYN 73
            :.|..|..|.||:.|...|.|:.:.|..|  .|:..|:.| |::.......|.:|.|||:|:||:
  Fly    27 MTNAVCETYNKSWVEFGLCRLRAVSRNKV--CLNVDANLLHPVHDVIVKARLLKRANGYKPWLYS 89

  Fly    74 MTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSGFYKL 138
            ::.|.|.|.: |:....:.:|::..|.:|.:||:||:.....|....|....: ..|.|:|.|.|
  Fly    90 VSFDGCQFIR-RRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKL-PTPIPTGEYLL 152

  Fly   139 M 139
            |
  Fly   153 M 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 25/77 (32%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.840

Return to query results.
Submit another query.